ZRF1 monoclonal antibody (M09), clone 3F2 View larger

ZRF1 monoclonal antibody (M09), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZRF1 monoclonal antibody (M09), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZRF1 monoclonal antibody (M09), clone 3F2

Brand: Abnova
Reference: H00027000-M09
Product name: ZRF1 monoclonal antibody (M09), clone 3F2
Product description: Mouse monoclonal antibody raised against a partial recombinant ZRF1.
Clone: 3F2
Isotype: IgG2a Kappa
Gene id: 27000
Gene name: DNAJC2
Gene alias: MPHOSPH11|MPP11|ZRF1|ZUO1
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 2
Genbank accession: XM_168590
Immunogen: ZRF1 (XP_168590.4, 408 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LDPHQKDDINKKAFDKFKKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAA
Protein accession: XP_168590.4
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027000-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027000-M09-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged DNAJC2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZRF1 monoclonal antibody (M09), clone 3F2 now

Add to cart