Brand: | Abnova |
Reference: | H00027000-M09 |
Product name: | ZRF1 monoclonal antibody (M09), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZRF1. |
Clone: | 3F2 |
Isotype: | IgG2a Kappa |
Gene id: | 27000 |
Gene name: | DNAJC2 |
Gene alias: | MPHOSPH11|MPP11|ZRF1|ZUO1 |
Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 2 |
Genbank accession: | XM_168590 |
Immunogen: | ZRF1 (XP_168590.4, 408 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LDPHQKDDINKKAFDKFKKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAA |
Protein accession: | XP_168590.4 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DNAJC2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |