Brand: | Abnova |
Reference: | H00026994-M01 |
Product name: | RNF11 monoclonal antibody (M01), clone 4G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF11. |
Clone: | 4G7 |
Isotype: | IgG2a Kappa |
Gene id: | 26994 |
Gene name: | RNF11 |
Gene alias: | CGI-123|MGC51169|SID1669 |
Gene description: | ring finger protein 11 |
Genbank accession: | NM_014372 |
Immunogen: | RNF11 (NP_055187, 65 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN |
Protein accession: | NP_055187 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RNF11 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Genome-wide Analysis of Pre-mRNA 3 End Processing Reveals a Decisive Role of Human Cleavage Factor I in the Regulation of 3 UTR Length.Martin G, Gruber AR, Keller W, Zavolan M. Cell Rep. 2012 Jun 28;1(6):753-63. |