RNF11 monoclonal antibody (M01), clone 4G7 View larger

RNF11 monoclonal antibody (M01), clone 4G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF11 monoclonal antibody (M01), clone 4G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about RNF11 monoclonal antibody (M01), clone 4G7

Brand: Abnova
Reference: H00026994-M01
Product name: RNF11 monoclonal antibody (M01), clone 4G7
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF11.
Clone: 4G7
Isotype: IgG2a Kappa
Gene id: 26994
Gene name: RNF11
Gene alias: CGI-123|MGC51169|SID1669
Gene description: ring finger protein 11
Genbank accession: NM_014372
Immunogen: RNF11 (NP_055187, 65 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
Protein accession: NP_055187
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026994-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026994-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to RNF11 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Genome-wide Analysis of Pre-mRNA 3 End Processing Reveals a Decisive Role of Human Cleavage Factor I in the Regulation of 3 UTR Length.Martin G, Gruber AR, Keller W, Zavolan M.
Cell Rep. 2012 Jun 28;1(6):753-63.

Reviews

Buy RNF11 monoclonal antibody (M01), clone 4G7 now

Add to cart