Brand: | Abnova |
Reference: | H00026994-A01 |
Product name: | RNF11 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RNF11. |
Gene id: | 26994 |
Gene name: | RNF11 |
Gene alias: | CGI-123|MGC51169|SID1669 |
Gene description: | ring finger protein 11 |
Genbank accession: | NM_014372 |
Immunogen: | RNF11 (NP_055187, 65 a.a. ~ 154 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN |
Protein accession: | NP_055187 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The ubiquitin-editing enzyme A20 requires RNF11 to downregulate NF-kappaB signalling.Shembade N, Parvatiyar K, Harhaj NS, Harhaj EW. EMBO J. 2009 Mar 4;28(5):513-22. Epub 2009 Jan 8. |