Cart 169 Product Products 62 260,43 € (empty)
No products
To be determined Shipping
62 260,43 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 169 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 62 260,43 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 62 260,43 €
Data sheet of SEC22L2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about SEC22L2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00026984-B01P |
| Product name: | SEC22L2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SEC22L2 protein. |
| Gene id: | 26984 |
| Gene name: | SEC22A |
| Gene alias: | SEC22L2 |
| Gene description: | SEC22 vesicle trafficking protein homolog A (S. cerevisiae) |
| Genbank accession: | BC007122 |
| Immunogen: | SEC22L2 (AAH07122, 1 a.a. ~ 307 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDV |
| Protein accession: | AAH07122 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SEC22A expression in transfected 293T cell line (H00026984-T01) by SEC22A MaxPab polyclonal antibody. Lane 1: SEC22L2 transfected lysate(33.88 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |