STEAP1 monoclonal antibody (M01A), clone 4F6-1F3 View larger

STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

Brand: Abnova
Reference: H00026872-M01A
Product name: STEAP1 monoclonal antibody (M01A), clone 4F6-1F3
Product description: Mouse monoclonal antibody raised against a full-length recombinant STEAP1.
Clone: 4F6-1F3
Isotype: IgG1 Kappa
Gene id: 26872
Gene name: STEAP1
Gene alias: MGC19484|PRSS24|STEAP
Gene description: six transmembrane epithelial antigen of the prostate 1
Genbank accession: BC011802
Immunogen: STEAP1 (AAH11802, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Protein accession: AAH11802
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026872-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (63.03 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026872-M01A-1-4-1.jpg
Application image note: STEAP1 monoclonal antibody (M01A), clone 4F6-1F3 Western Blot analysis of STEAP1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy STEAP1 monoclonal antibody (M01A), clone 4F6-1F3 now

Add to cart