Brand: | Abnova |
Reference: | H00026872-M01 |
Product name: | STEAP1 monoclonal antibody (M01), clone 4F6-1F3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant STEAP1. |
Clone: | 4F6-1F3 |
Isotype: | IgG1 Kappa |
Gene id: | 26872 |
Gene name: | STEAP1 |
Gene alias: | MGC19484|PRSS24|STEAP |
Gene description: | six transmembrane epithelial antigen of the prostate 1 |
Genbank accession: | BC011802 |
Immunogen: | STEAP1 (AAH11802, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL |
Protein accession: | AAH11802 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (63.03 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | STEAP1 monoclonal antibody (M01), clone 4F6-1F3 Western Blot analysis of STEAP1 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |