Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00026762-M02 |
Product name: | HAVCR1 monoclonal antibody (M02), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HAVCR1. |
Clone: | 2B9 |
Isotype: | IgG2a Kappa |
Gene id: | 26762 |
Gene name: | HAVCR1 |
Gene alias: | HAVCR|HAVCR-1|KIM-1|KIM1|TIM-1|TIM1|TIMD1 |
Gene description: | hepatitis A virus cellular receptor 1 |
Genbank accession: | NM_012206 |
Immunogen: | HAVCR1 (NP_036338, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSL |
Protein accession: | NP_036338 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HAVCR1 expression in transfected 293T cell line by HAVCR1 monoclonal antibody (M02), clone 2B9. Lane 1: HAVCR1 transfected lysate(38.72 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |