HAVCR1 monoclonal antibody (M01), clone 1E5 View larger

HAVCR1 monoclonal antibody (M01), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HAVCR1 monoclonal antibody (M01), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr

More info about HAVCR1 monoclonal antibody (M01), clone 1E5

Brand: Abnova
Reference: H00026762-M01
Product name: HAVCR1 monoclonal antibody (M01), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant HAVCR1.
Clone: 1E5
Isotype: IgG2a Kappa
Gene id: 26762
Gene name: HAVCR1
Gene alias: HAVCR|HAVCR-1|KIM-1|KIM1|TIM-1|TIM1|TIMD1
Gene description: hepatitis A virus cellular receptor 1
Genbank accession: NM_012206
Immunogen: HAVCR1 (NP_036338, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSL
Protein accession: NP_036338
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026762-M01-13-15-1.jpg
Application image note: Western Blot analysis of HAVCR1 expression in transfected 293T cell line by HAVCR1 monoclonal antibody (M01), clone 1E5.

Lane 1: HAVCR1 transfected lysate(38.72 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HAVCR1 monoclonal antibody (M01), clone 1E5 now

Add to cart