Brand: | Abnova |
Reference: | H00026762-A01 |
Product name: | HAVCR1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HAVCR1. |
Gene id: | 26762 |
Gene name: | HAVCR1 |
Gene alias: | HAVCR|HAVCR-1|KIM-1|KIM1|TIM-1|TIM1|TIMD1 |
Gene description: | hepatitis A virus cellular receptor 1 |
Genbank accession: | NM_012206 |
Immunogen: | HAVCR1 (NP_036338, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSL |
Protein accession: | NP_036338 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HAVCR1 polyclonal antibody (A01), Lot # ABNOVA060707QCS1 Western Blot analysis of HAVCR1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |