Brand: | Abnova |
Reference: | H00026750-M01A |
Product name: | RPS6KC1 monoclonal antibody (M01A), clone 4C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KC1. |
Clone: | 4C6 |
Isotype: | IgG2a Kappa |
Gene id: | 26750 |
Gene name: | RPS6KC1 |
Gene alias: | RPK118|humS6PKh1 |
Gene description: | ribosomal protein S6 kinase, 52kDa, polypeptide 1 |
Genbank accession: | NM_012424 |
Immunogen: | RPS6KC1 (NP_036556, 957 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SCDSDAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR |
Protein accession: | NP_036556 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RPS6KC1 monoclonal antibody (M01A), clone 4C6. Western Blot analysis of RPS6KC1 expression in HepG2. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |