RPS6KC1 monoclonal antibody (M01), clone 4C6 View larger

RPS6KC1 monoclonal antibody (M01), clone 4C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS6KC1 monoclonal antibody (M01), clone 4C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RPS6KC1 monoclonal antibody (M01), clone 4C6

Brand: Abnova
Reference: H00026750-M01
Product name: RPS6KC1 monoclonal antibody (M01), clone 4C6
Product description: Mouse monoclonal antibody raised against a partial recombinant RPS6KC1.
Clone: 4C6
Isotype: IgG2a Kappa
Gene id: 26750
Gene name: RPS6KC1
Gene alias: RPK118|humS6PKh1
Gene description: ribosomal protein S6 kinase, 52kDa, polypeptide 1
Genbank accession: NM_012424
Immunogen: RPS6KC1 (NP_036556, 957 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SCDSDAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR
Protein accession: NP_036556
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026750-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026750-M01-1-12-1.jpg
Application image note: RPS6KC1 monoclonal antibody (M01), clone 4C6. Western Blot analysis of RPS6KC1 expression in HepG2.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPS6KC1 monoclonal antibody (M01), clone 4C6 now

Add to cart