NUFIP1 MaxPab mouse polyclonal antibody (B02) View larger

NUFIP1 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUFIP1 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about NUFIP1 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00026747-B02
Product name: NUFIP1 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human NUFIP1 protein.
Gene id: 26747
Gene name: NUFIP1
Gene alias: NUFIP|bA540M5.1
Gene description: nuclear fragile X mental retardation protein interacting protein 1
Genbank accession: BC017745
Immunogen: NUFIP1 (AAH17745, 1 a.a. ~ 276 a.a) full-length human protein.
Immunogen sequence/protein sequence: MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV
Protein accession: AAH17745
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026747-B02-13-15-1.jpg
Application image note: Western Blot analysis of NUFIP1 expression in transfected 293T cell line (H00026747-T02) by NUFIP1 MaxPab polyclonal antibody.

Lane 1: NUFIP1 transfected lysate(30.36 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUFIP1 MaxPab mouse polyclonal antibody (B02) now

Add to cart