CKAP2 monoclonal antibody (M08), clone 3B9 View larger

CKAP2 monoclonal antibody (M08), clone 3B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKAP2 monoclonal antibody (M08), clone 3B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CKAP2 monoclonal antibody (M08), clone 3B9

Brand: Abnova
Reference: H00026586-M08
Product name: CKAP2 monoclonal antibody (M08), clone 3B9
Product description: Mouse monoclonal antibody raised against a full-length recombinant CKAP2.
Clone: 3B9
Isotype: IgG2a Kappa
Gene id: 26586
Gene name: CKAP2
Gene alias: DKFZp686L1238|FLJ10749|LB1|TMAP|se20-10
Gene description: cytoskeleton associated protein 2
Genbank accession: BC010901
Immunogen: CKAP2 (AAH10901.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR
Protein accession: AAH10901.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026586-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026586-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CKAP2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CKAP2 monoclonal antibody (M08), clone 3B9 now

Add to cart