Brand: | Abnova |
Reference: | H00026586-M08 |
Product name: | CKAP2 monoclonal antibody (M08), clone 3B9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CKAP2. |
Clone: | 3B9 |
Isotype: | IgG2a Kappa |
Gene id: | 26586 |
Gene name: | CKAP2 |
Gene alias: | DKFZp686L1238|FLJ10749|LB1|TMAP|se20-10 |
Gene description: | cytoskeleton associated protein 2 |
Genbank accession: | BC010901 |
Immunogen: | CKAP2 (AAH10901.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR |
Protein accession: | AAH10901.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.45 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CKAP2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |