Brand: | Abnova |
Reference: | H00026586-A01 |
Product name: | CKAP2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CKAP2. |
Gene id: | 26586 |
Gene name: | CKAP2 |
Gene alias: | DKFZp686L1238|FLJ10749|LB1|TMAP|se20-10 |
Gene description: | cytoskeleton associated protein 2 |
Genbank accession: | BC010901 |
Immunogen: | CKAP2 (AAH10901.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR |
Protein accession: | AAH10901.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.82 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |