GREM1 monoclonal antibody (M04), clone 4C2 View larger

GREM1 monoclonal antibody (M04), clone 4C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GREM1 monoclonal antibody (M04), clone 4C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GREM1 monoclonal antibody (M04), clone 4C2

Brand: Abnova
Reference: H00026585-M04
Product name: GREM1 monoclonal antibody (M04), clone 4C2
Product description: Mouse monoclonal antibody raised against a partial recombinant GREM1.
Clone: 4C2
Isotype: IgG2a Kappa
Gene id: 26585
Gene name: GREM1
Gene alias: CKTSF1B1|DAND2|DRM|GREMLIN|IHG-2|MGC126660|PIG2
Gene description: gremlin 1, cysteine knot superfamily, homolog (Xenopus laevis)
Genbank accession: NM_013372
Immunogen: GREM1 (NP_037504, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD
Protein accession: NP_037504
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026585-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026585-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged GREM1 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GREM1 monoclonal antibody (M04), clone 4C2 now

Add to cart