Brand: | Abnova |
Reference: | H00026585-M02A |
Product name: | GREM1 monoclonal antibody (M02A), clone 2C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GREM1. |
Clone: | 2C8 |
Isotype: | IgM Kappa |
Gene id: | 26585 |
Gene name: | GREM1 |
Gene alias: | CKTSF1B1|DAND2|DRM|GREMLIN|IHG-2|MGC126660|PIG2 |
Gene description: | gremlin 1, cysteine knot superfamily, homolog (Xenopus laevis) |
Genbank accession: | NM_013372 |
Immunogen: | GREM1 (NP_037504, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD |
Protein accession: | NP_037504 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |