BSCL2 monoclonal antibody (M01), clone 1G4 View larger

BSCL2 monoclonal antibody (M01), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BSCL2 monoclonal antibody (M01), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BSCL2 monoclonal antibody (M01), clone 1G4

Brand: Abnova
Reference: H00026580-M01
Product name: BSCL2 monoclonal antibody (M01), clone 1G4
Product description: Mouse monoclonal antibody raised against a partial recombinant BSCL2.
Clone: 1G4
Isotype: IgG1 Kappa
Gene id: 26580
Gene name: BSCL2
Gene alias: GNG3LG|HMN5|MGC4694|SPG17
Gene description: Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
Genbank accession: NM_032667
Immunogen: BSCL2 (NP_116056, 259 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAAL
Protein accession: NP_116056
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026580-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026580-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged BSCL2 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BSCL2 monoclonal antibody (M01), clone 1G4 now

Add to cart