RGS17 monoclonal antibody (M01A), clone 2H4 View larger

RGS17 monoclonal antibody (M01A), clone 2H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGS17 monoclonal antibody (M01A), clone 2H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RGS17 monoclonal antibody (M01A), clone 2H4

Brand: Abnova
Reference: H00026575-M01A
Product name: RGS17 monoclonal antibody (M01A), clone 2H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant RGS17.
Clone: 2H4
Isotype: IgM Kappa
Gene id: 26575
Gene name: RGS17
Gene alias: RGS-17|RGSZ2|hRGS17
Gene description: regulator of G-protein signaling 17
Genbank accession: BC013117
Immunogen: RGS17 (AAH13117, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Protein accession: AAH13117
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026575-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (48.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RGS17 monoclonal antibody (M01A), clone 2H4 now

Add to cart