AATF monoclonal antibody (M09), clone 2H6 View larger

AATF monoclonal antibody (M09), clone 2H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AATF monoclonal antibody (M09), clone 2H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about AATF monoclonal antibody (M09), clone 2H6

Brand: Abnova
Reference: H00026574-M09
Product name: AATF monoclonal antibody (M09), clone 2H6
Product description: Mouse monoclonal antibody raised against a partial recombinant AATF.
Clone: 2H6
Isotype: IgG1 Kappa
Gene id: 26574
Gene name: AATF
Gene alias: CHE-1|CHE1|DED
Gene description: apoptosis antagonizing transcription factor
Genbank accession: BC000591
Immunogen: AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
Protein accession: AAH00591
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026574-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026574-M09-1-1-1.jpg
Application image note: AATF monoclonal antibody (M09), clone 2H6 Western Blot analysis of AATF expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AATF monoclonal antibody (M09), clone 2H6 now

Add to cart