ITGB1BP2 monoclonal antibody (M02), clone 3G9 View larger

ITGB1BP2 monoclonal antibody (M02), clone 3G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ITGB1BP2 monoclonal antibody (M02), clone 3G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ITGB1BP2 monoclonal antibody (M02), clone 3G9

Brand: Abnova
Reference: H00026548-M02
Product name: ITGB1BP2 monoclonal antibody (M02), clone 3G9
Product description: Mouse monoclonal antibody raised against a partial recombinant ITGB1BP2.
Clone: 3G9
Isotype: IgG2a Kappa
Gene id: 26548
Gene name: ITGB1BP2
Gene alias: CHORDC3|ITGB1BP|MELUSIN|MGC119214|MSTP015
Gene description: integrin beta 1 binding protein (melusin) 2
Genbank accession: NM_012278
Immunogen: ITGB1BP2 (NP_036410, 246 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVL
Protein accession: NP_036410
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026548-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.88 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026548-M02-13-15-1.jpg
Application image note: Western Blot analysis of ITGB1BP2 expression in transfected 293T cell line by ITGB1BP2 monoclonal antibody (M02), clone 3G9.

Lane 1: ITGB1BP2 transfected lysate (Predicted MW: 38.4 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ITGB1BP2 monoclonal antibody (M02), clone 3G9 now

Add to cart