DAZAP1 monoclonal antibody (M03), clone 2F6 View larger

DAZAP1 monoclonal antibody (M03), clone 2F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DAZAP1 monoclonal antibody (M03), clone 2F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about DAZAP1 monoclonal antibody (M03), clone 2F6

Brand: Abnova
Reference: H00026528-M03
Product name: DAZAP1 monoclonal antibody (M03), clone 2F6
Product description: Mouse monoclonal antibody raised against a partial recombinant DAZAP1.
Clone: 2F6
Isotype: IgG1 Kappa
Gene id: 26528
Gene name: DAZAP1
Gene alias: MGC19907
Gene description: DAZ associated protein 1
Genbank accession: NM_018959
Immunogen: DAZAP1 (NP_061832.2, 308 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Protein accession: NP_061832.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026528-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026528-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged DAZAP1 is 0.03 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DAZAP1 monoclonal antibody (M03), clone 2F6 now

Add to cart