DAZAP1 MaxPab mouse polyclonal antibody (B01) View larger

DAZAP1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DAZAP1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about DAZAP1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00026528-B01
Product name: DAZAP1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DAZAP1 protein.
Gene id: 26528
Gene name: DAZAP1
Gene alias: MGC19907
Gene description: DAZ associated protein 1
Genbank accession: NM_018959
Immunogen: DAZAP1 (NP_061832, 1 a.a. ~ 407 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Protein accession: NP_061832
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026528-B01-13-15-1.jpg
Application image note: Western Blot analysis of DAZAP1 expression in transfected 293T cell line (H00026528-T01) by DAZAP1 MaxPab polyclonal antibody.

Lane 1: DAZAP1 transfected lysate(44.77 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DAZAP1 MaxPab mouse polyclonal antibody (B01) now

Add to cart