TIMM8B monoclonal antibody (M15), clone 8E5 View larger

TIMM8B monoclonal antibody (M15), clone 8E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM8B monoclonal antibody (M15), clone 8E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TIMM8B monoclonal antibody (M15), clone 8E5

Brand: Abnova
Reference: H00026521-M15
Product name: TIMM8B monoclonal antibody (M15), clone 8E5
Product description: Mouse monoclonal antibody raised against a full-length recombinant TIMM8B.
Clone: 8E5
Isotype: IgG2a Kappa
Gene id: 26521
Gene name: TIMM8B
Gene alias: DDP2|FLJ21744|MGC102866|MGC117373|TIM8B
Gene description: translocase of inner mitochondrial membrane 8 homolog B (yeast)
Genbank accession: NM_012459.1
Immunogen: TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Protein accession: NP_036591.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026521-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026521-M15-13-15-1.jpg
Application image note: Western Blot analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody (M15), clone 8E5.

Lane 1: TIMM8B transfected lysate(9.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TIMM8B monoclonal antibody (M15), clone 8E5 now

Add to cart