Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00026521-M15 |
Product name: | TIMM8B monoclonal antibody (M15), clone 8E5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TIMM8B. |
Clone: | 8E5 |
Isotype: | IgG2a Kappa |
Gene id: | 26521 |
Gene name: | TIMM8B |
Gene alias: | DDP2|FLJ21744|MGC102866|MGC117373|TIM8B |
Gene description: | translocase of inner mitochondrial membrane 8 homolog B (yeast) |
Genbank accession: | NM_012459.1 |
Immunogen: | TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ |
Protein accession: | NP_036591.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody (M15), clone 8E5. Lane 1: TIMM8B transfected lysate(9.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |