TIMM8B monoclonal antibody (M03), clone 3C8 View larger

TIMM8B monoclonal antibody (M03), clone 3C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM8B monoclonal antibody (M03), clone 3C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TIMM8B monoclonal antibody (M03), clone 3C8

Brand: Abnova
Reference: H00026521-M03
Product name: TIMM8B monoclonal antibody (M03), clone 3C8
Product description: Mouse monoclonal antibody raised against a partial recombinant TIMM8B.
Clone: 3C8
Isotype: IgG1 Kappa
Gene id: 26521
Gene name: TIMM8B
Gene alias: DDP2|FLJ21744|MGC102866|MGC117373|TIM8B
Gene description: translocase of inner mitochondrial membrane 8 homolog B (yeast)
Genbank accession: NM_012459
Immunogen: TIMM8B (NP_036591, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Protein accession: NP_036591
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026521-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026521-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TIMM8B is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TIMM8B monoclonal antibody (M03), clone 3C8 now

Add to cart