TIMM9 monoclonal antibody (M01), clone 1D6 View larger

TIMM9 monoclonal antibody (M01), clone 1D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM9 monoclonal antibody (M01), clone 1D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TIMM9 monoclonal antibody (M01), clone 1D6

Brand: Abnova
Reference: H00026520-M01
Product name: TIMM9 monoclonal antibody (M01), clone 1D6
Product description: Mouse monoclonal antibody raised against a full length recombinant TIMM9.
Clone: 1D6
Isotype: IgG2a Kappa
Gene id: 26520
Gene name: TIMM9
Gene alias: TIM9|TIM9A
Gene description: translocase of inner mitochondrial membrane 9 homolog (yeast)
Genbank accession: BC020213
Immunogen: TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Protein accession: AAH20213
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026520-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00026520-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: High expression of mitochondrial intermembrane chaperone TIMM9 represents a negative prognostic marker in gastric cancer.Lin CC, Fang CL, Sun DP, Hseu YC, Uen YH, Lin KY, Lin YC.
J Formos Med Assoc. 2016 Oct 6. [Epub ahead of print]

Reviews

Buy TIMM9 monoclonal antibody (M01), clone 1D6 now

Add to cart