TIMM13 monoclonal antibody (M03A), clone 4F4 View larger

TIMM13 monoclonal antibody (M03A), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM13 monoclonal antibody (M03A), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TIMM13 monoclonal antibody (M03A), clone 4F4

Brand: Abnova
Reference: H00026517-M03A
Product name: TIMM13 monoclonal antibody (M03A), clone 4F4
Product description: Mouse monoclonal antibody raised against a full-length recombinant TIMM13.
Clone: 4F4
Isotype: IgM Kappa
Gene id: 26517
Gene name: TIMM13
Gene alias: TIM13|TIM13B|TIMM13A|TIMM13B|ppv1
Gene description: translocase of inner mitochondrial membrane 13 homolog (yeast)
Genbank accession: BC008607
Immunogen: TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Protein accession: AAH08607
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026517-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.Lin SJ, Chang KP, Hsu CW, Chi LM, Chien KY, Liang Y, Tsai MH, Lin YT, Yu JS
J Proteomics. 2013 Sep 27;94C:186-201. doi: 10.1016/j.jprot.2013.09.013.

Reviews

Buy TIMM13 monoclonal antibody (M03A), clone 4F4 now

Add to cart