Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TIMM13 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TIMM13 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00026517-A01 |
| Product name: | TIMM13 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant TIMM13. |
| Gene id: | 26517 |
| Gene name: | TIMM13 |
| Gene alias: | TIM13|TIM13B|TIMM13A|TIMM13B|ppv1 |
| Gene description: | translocase of inner mitochondrial membrane 13 homolog (yeast) |
| Genbank accession: | BC008607 |
| Immunogen: | TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM |
| Protein accession: | AAH08607 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Nucleocytoplasmic human O-GlcNAc transferase is sufficient for O-GlcNAcylation of mitochondrial proteins.Trapannone R, Mariappa D, Ferenbach AT, van Aalten DM. Biochem J. 2016 Apr 5;473(12):1693-702. |