Brand: | Abnova |
Reference: | H00026515-M04 |
Product name: | FXC1 monoclonal antibody (M04), clone 1A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FXC1. |
Clone: | 1A11 |
Isotype: | IgG2a Kappa |
Gene id: | 26515 |
Gene name: | FXC1 |
Gene alias: | TIM10B|TIMM10B|Tim9b |
Gene description: | fracture callus 1 homolog (rat) |
Genbank accession: | NM_012192 |
Immunogen: | FXC1 (NP_036324.1, 11 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS |
Protein accession: | NP_036324.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FXC1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |