FXC1 monoclonal antibody (M04), clone 1A11 View larger

FXC1 monoclonal antibody (M04), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FXC1 monoclonal antibody (M04), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FXC1 monoclonal antibody (M04), clone 1A11

Brand: Abnova
Reference: H00026515-M04
Product name: FXC1 monoclonal antibody (M04), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant FXC1.
Clone: 1A11
Isotype: IgG2a Kappa
Gene id: 26515
Gene name: FXC1
Gene alias: TIM10B|TIMM10B|Tim9b
Gene description: fracture callus 1 homolog (rat)
Genbank accession: NM_012192
Immunogen: FXC1 (NP_036324.1, 11 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Protein accession: NP_036324.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026515-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026515-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FXC1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FXC1 monoclonal antibody (M04), clone 1A11 now

Add to cart