Brand: | Abnova |
Reference: | H00026508-M22 |
Product name: | HEYL monoclonal antibody (M22), clone 2E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HEYL. |
Clone: | 2E12 |
Isotype: | IgG2a Kappa |
Gene id: | 26508 |
Gene name: | HEYL |
Gene alias: | HRT3|MGC12623|bHLHb33 |
Gene description: | hairy/enhancer-of-split related with YRPW motif-like |
Genbank accession: | NM_014571 |
Immunogen: | HEYL (NP_055386, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV |
Protein accession: | NP_055386 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HEYL monoclonal antibody (M22), clone 2E12. Western Blot analysis of HEYL expression in human kidney. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |