HEYL monoclonal antibody (M15), clone 1E2 View larger

HEYL monoclonal antibody (M15), clone 1E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEYL monoclonal antibody (M15), clone 1E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HEYL monoclonal antibody (M15), clone 1E2

Brand: Abnova
Reference: H00026508-M15
Product name: HEYL monoclonal antibody (M15), clone 1E2
Product description: Mouse monoclonal antibody raised against a full length recombinant HEYL.
Clone: 1E2
Isotype: IgG2b Kappa
Gene id: 26508
Gene name: HEYL
Gene alias: HRT3|MGC12623|bHLHb33
Gene description: hairy/enhancer-of-split related with YRPW motif-like
Genbank accession: NM_014571
Immunogen: HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV
Protein accession: NP_055386
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026508-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026508-M15-1-18-1.jpg
Application image note: HEYL monoclonal antibody (M15), clone 1E2 Western Blot analysis of HEYL expression in COLO 320 HSR ( Cat # L020V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HEYL monoclonal antibody (M15), clone 1E2 now

Add to cart