Brand: | Abnova |
Reference: | H00026472-M07 |
Product name: | PPP1R14B monoclonal antibody (M07), clone 4G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP1R14B. |
Clone: | 4G2 |
Isotype: | IgG2a Kappa |
Gene id: | 26472 |
Gene name: | PPP1R14B |
Gene alias: | PHI-1|PLCB3N|PNG|SOM172 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 14B |
Genbank accession: | NM_138689 |
Immunogen: | PPP1R14B (NP_619634.1, 64 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQ |
Protein accession: | NP_619634.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PPP1R14B is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |