PPP1R14B monoclonal antibody (M07), clone 4G2 View larger

PPP1R14B monoclonal antibody (M07), clone 4G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R14B monoclonal antibody (M07), clone 4G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PPP1R14B monoclonal antibody (M07), clone 4G2

Brand: Abnova
Reference: H00026472-M07
Product name: PPP1R14B monoclonal antibody (M07), clone 4G2
Product description: Mouse monoclonal antibody raised against a partial recombinant PPP1R14B.
Clone: 4G2
Isotype: IgG2a Kappa
Gene id: 26472
Gene name: PPP1R14B
Gene alias: PHI-1|PLCB3N|PNG|SOM172
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 14B
Genbank accession: NM_138689
Immunogen: PPP1R14B (NP_619634.1, 64 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQ
Protein accession: NP_619634.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026472-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026472-M07-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PPP1R14B is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP1R14B monoclonal antibody (M07), clone 4G2 now

Add to cart