LHX6 monoclonal antibody (M05), clone 3E8 View larger

LHX6 monoclonal antibody (M05), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LHX6 monoclonal antibody (M05), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about LHX6 monoclonal antibody (M05), clone 3E8

Brand: Abnova
Reference: H00026468-M05
Product name: LHX6 monoclonal antibody (M05), clone 3E8
Product description: Mouse monoclonal antibody raised against a partial recombinant LHX6.
Clone: 3E8
Isotype: IgG2b Kappa
Gene id: 26468
Gene name: LHX6
Gene alias: LHX6.1|MGC119542|MGC119544|MGC119545
Gene description: LIM homeobox 6
Genbank accession: NM_014368
Immunogen: LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Protein accession: NP_055183
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026468-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00026468-M05-1-12-1.jpg
Application image note: LHX6 monoclonal antibody (M05), clone 3E8 Western Blot analysis of LHX6 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LHX6 monoclonal antibody (M05), clone 3E8 now

Add to cart