GNL3 monoclonal antibody (M01), clone 1A1 View larger

GNL3 monoclonal antibody (M01), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNL3 monoclonal antibody (M01), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GNL3 monoclonal antibody (M01), clone 1A1

Brand: Abnova
Reference: H00026354-M01
Product name: GNL3 monoclonal antibody (M01), clone 1A1
Product description: Mouse monoclonal antibody raised against a full length recombinant GNL3.
Clone: 1A1
Isotype: IgG2a Kappa
Gene id: 26354
Gene name: GNL3
Gene alias: C77032|E2IG3|MGC800|NS
Gene description: guanine nucleotide binding protein-like 3 (nucleolar)
Genbank accession: BC001024
Immunogen: GNL3 (AAH01024.1, 328 a.a. ~ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF
Protein accession: AAH01024.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026354-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026354-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GNL3 monoclonal antibody (M01), clone 1A1 now

Add to cart