HSPB8 monoclonal antibody (M12), clone 3C5 View larger

HSPB8 monoclonal antibody (M12), clone 3C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPB8 monoclonal antibody (M12), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about HSPB8 monoclonal antibody (M12), clone 3C5

Brand: Abnova
Reference: H00026353-M12
Product name: HSPB8 monoclonal antibody (M12), clone 3C5
Product description: Mouse monoclonal antibody raised against a full-length recombinant HSPB8.
Clone: 3C5
Isotype: IgG1 Kappa
Gene id: 26353
Gene name: HSPB8
Gene alias: CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22
Gene description: heat shock 22kDa protein 8
Genbank accession: BC002673
Immunogen: HSPB8 (AAH02673.1, 1 a.a. ~ 196 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Protein accession: AAH02673.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026353-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026353-M12-1-1-1.jpg
Application image note: HSPB8 monoclonal antibody (M12), clone 3C5. Western Blot analysis of HSPB8 expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: NFκB is a central regulator of protein quality control in response to protein aggregation stresses via autophagy modulation.Nivon M, Fort L, Muller P, Richet E, Simon S, Guey B, Fournier M, Arrigo AP, Hetz C, Atkin JD, Kretz-Remy C.
Mol Biol Cell. 2016 Apr 13. [Epub ahead of print]

Reviews

Buy HSPB8 monoclonal antibody (M12), clone 3C5 now

Add to cart