HSPB8 monoclonal antibody (M04), clone 5B12 View larger

HSPB8 monoclonal antibody (M04), clone 5B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPB8 monoclonal antibody (M04), clone 5B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about HSPB8 monoclonal antibody (M04), clone 5B12

Brand: Abnova
Reference: H00026353-M04
Product name: HSPB8 monoclonal antibody (M04), clone 5B12
Product description: Mouse monoclonal antibody raised against a partial recombinant HSPB8.
Clone: 5B12
Isotype: IgG2a Kappa
Gene id: 26353
Gene name: HSPB8
Gene alias: CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22
Gene description: heat shock 22kDa protein 8
Genbank accession: NM_014365
Immunogen: HSPB8 (NP_055180, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Protein accession: NP_055180
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026353-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026353-M04-13-15-1.jpg
Application image note: Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M04), clone 5B12.

Lane 1: HSPB8 transfected lysate(35.446 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Modulation of Protein Quality Control and Proteasome to Autophagy Switch in Immortalized Myoblasts from Duchenne Muscular Dystrophy Patients.Wattin M, Gaweda L, Muller P, Baritaud M, Scholtes C, Lozano C, Gieseler K, Kretz-Remy C.
Int J Mol Sci. 2018 Jan 7;19(1). pii: E178.

Reviews

Buy HSPB8 monoclonal antibody (M04), clone 5B12 now

Add to cart