HSPB8 monoclonal antibody (M03), clone 5C3 View larger

HSPB8 monoclonal antibody (M03), clone 5C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPB8 monoclonal antibody (M03), clone 5C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HSPB8 monoclonal antibody (M03), clone 5C3

Brand: Abnova
Reference: H00026353-M03
Product name: HSPB8 monoclonal antibody (M03), clone 5C3
Product description: Mouse monoclonal antibody raised against a partial recombinant HSPB8.
Clone: 5C3
Isotype: IgG2b Kappa
Gene id: 26353
Gene name: HSPB8
Gene alias: CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22
Gene description: heat shock 22kDa protein 8
Genbank accession: NM_014365
Immunogen: HSPB8 (NP_055180, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Protein accession: NP_055180
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026353-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026353-M03-13-15-1.jpg
Application image note: Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M03), clone 5C3.

Lane 1: HSPB8 transfected lysate(35.446 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSPB8 monoclonal antibody (M03), clone 5C3 now

Add to cart