DELGEF monoclonal antibody (M01), clone 1A2 View larger

DELGEF monoclonal antibody (M01), clone 1A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DELGEF monoclonal antibody (M01), clone 1A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about DELGEF monoclonal antibody (M01), clone 1A2

Brand: Abnova
Reference: H00026297-M01
Product name: DELGEF monoclonal antibody (M01), clone 1A2
Product description: Mouse monoclonal antibody raised against a partial recombinant DELGEF.
Clone: 1A2
Isotype: IgG1 Kappa
Gene id: 26297
Gene name: SERGEF
Gene alias: DELGEF|Gnefr
Gene description: secretion regulating guanine nucleotide exchange factor
Genbank accession: NM_012139
Immunogen: DELGEF (NP_036271, 240 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE
Protein accession: NP_036271
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026297-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SERGEF is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy DELGEF monoclonal antibody (M01), clone 1A2 now

Add to cart