Brand: | Abnova |
Reference: | H00026297-M01 |
Product name: | DELGEF monoclonal antibody (M01), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DELGEF. |
Clone: | 1A2 |
Isotype: | IgG1 Kappa |
Gene id: | 26297 |
Gene name: | SERGEF |
Gene alias: | DELGEF|Gnefr |
Gene description: | secretion regulating guanine nucleotide exchange factor |
Genbank accession: | NM_012139 |
Immunogen: | DELGEF (NP_036271, 240 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE |
Protein accession: | NP_036271 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SERGEF is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |