MYCBP monoclonal antibody (M13), clone 1B12 View larger

MYCBP monoclonal antibody (M13), clone 1B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYCBP monoclonal antibody (M13), clone 1B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about MYCBP monoclonal antibody (M13), clone 1B12

Brand: Abnova
Reference: H00026292-M13
Product name: MYCBP monoclonal antibody (M13), clone 1B12
Product description: Mouse monoclonal antibody raised against a partial recombinant MYCBP.
Clone: 1B12
Isotype: IgG2a Kappa
Gene id: 26292
Gene name: MYCBP
Gene alias: AMY-1
Gene description: c-myc binding protein
Genbank accession: NM_012333
Immunogen: MYCBP (NP_036465.2, 34 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Protein accession: NP_036465.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026292-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026292-M13-13-15-1.jpg
Application image note: Western Blot analysis of MYCBP expression in transfected 293T cell line by MYCBP monoclonal antibody (M13), clone 1B12.

Lane 1: MYCBP transfected lysate(12 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MYCBP monoclonal antibody (M13), clone 1B12 now

Add to cart