MYCBP monoclonal antibody (M02), clone 2E9 View larger

MYCBP monoclonal antibody (M02), clone 2E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYCBP monoclonal antibody (M02), clone 2E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about MYCBP monoclonal antibody (M02), clone 2E9

Brand: Abnova
Reference: H00026292-M02
Product name: MYCBP monoclonal antibody (M02), clone 2E9
Product description: Mouse monoclonal antibody raised against a full-length recombinant MYCBP.
Clone: 2E9
Isotype: IgG2b Kappa
Gene id: 26292
Gene name: MYCBP
Gene alias: AMY-1
Gene description: c-myc binding protein
Genbank accession: BC008686
Immunogen: MYCBP (AAH08686, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Protein accession: AAH08686
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026292-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026292-M02-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MYCBP on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MYCBP monoclonal antibody (M02), clone 2E9 now

Add to cart