Brand: | Abnova |
Reference: | H00026292-M02 |
Product name: | MYCBP monoclonal antibody (M02), clone 2E9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MYCBP. |
Clone: | 2E9 |
Isotype: | IgG2b Kappa |
Gene id: | 26292 |
Gene name: | MYCBP |
Gene alias: | AMY-1 |
Gene description: | c-myc binding protein |
Genbank accession: | BC008686 |
Immunogen: | MYCBP (AAH08686, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE |
Protein accession: | AAH08686 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MYCBP on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |