FGF21 monoclonal antibody (M06A), clone 3E20 View larger

FGF21 monoclonal antibody (M06A), clone 3E20

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGF21 monoclonal antibody (M06A), clone 3E20

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FGF21 monoclonal antibody (M06A), clone 3E20

Brand: Abnova
Reference: H00026291-M06A
Product name: FGF21 monoclonal antibody (M06A), clone 3E20
Product description: Mouse monoclonal antibody raised against a full-length recombinant FGF21.
Clone: 3E20
Isotype: IgM Kappa
Gene id: 26291
Gene name: FGF21
Gene alias: -
Gene description: fibroblast growth factor 21
Genbank accession: BC018404
Immunogen: FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Protein accession: AAH18404
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026291-M06A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FGF21 monoclonal antibody (M06A), clone 3E20 now

Add to cart