FGF21 monoclonal antibody (M01), clone 2F11 View larger

FGF21 monoclonal antibody (M01), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGF21 monoclonal antibody (M01), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about FGF21 monoclonal antibody (M01), clone 2F11

Brand: Abnova
Reference: H00026291-M01
Product name: FGF21 monoclonal antibody (M01), clone 2F11
Product description: Mouse monoclonal antibody raised against a full length recombinant FGF21.
Clone: 2F11
Isotype: IgG1 Kappa
Gene id: 26291
Gene name: FGF21
Gene alias: -
Gene description: fibroblast growth factor 21
Genbank accession: BC018404
Immunogen: FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Protein accession: AAH18404
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026291-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026291-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FGF21 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FGF21 monoclonal antibody (M01), clone 2F11 now

Add to cart