TINF2 monoclonal antibody (M02), clone 3G11 View larger

TINF2 monoclonal antibody (M02), clone 3G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TINF2 monoclonal antibody (M02), clone 3G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TINF2 monoclonal antibody (M02), clone 3G11

Brand: Abnova
Reference: H00026277-M02
Product name: TINF2 monoclonal antibody (M02), clone 3G11
Product description: Mouse monoclonal antibody raised against a partial recombinant TINF2.
Clone: 3G11
Isotype: IgG2b Kappa
Gene id: 26277
Gene name: TINF2
Gene alias: TIN2|TIN2L
Gene description: TERF1 (TRF1)-interacting nuclear factor 2
Genbank accession: NM_012461
Immunogen: TINF2 (NP_036593, 256 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISNPESKEEHAIYTADLAMGTRAPSNGKYKGPYQTLGGRALKENPVDLPATEQKE
Protein accession: NP_036593
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026277-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026277-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TINF2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TINF2 monoclonal antibody (M02), clone 3G11 now

Add to cart