VPS33B monoclonal antibody (M01), clone 3E11 View larger

VPS33B monoclonal antibody (M01), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPS33B monoclonal antibody (M01), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about VPS33B monoclonal antibody (M01), clone 3E11

Brand: Abnova
Reference: H00026276-M01
Product name: VPS33B monoclonal antibody (M01), clone 3E11
Product description: Mouse monoclonal antibody raised against a partial recombinant VPS33B.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 26276
Gene name: VPS33B
Gene alias: FLJ14848
Gene description: vacuolar protein sorting 33 homolog B (yeast)
Genbank accession: NM_018668.3
Immunogen: VPS33B (NP_061138.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQHEVDKLYKVENKPALSSNEQLCFLVRPRIKNMRYIASLVN
Protein accession: NP_061138.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026276-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026276-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged VPS33B is 3 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VPS33B monoclonal antibody (M01), clone 3E11 now

Add to cart