FBXO5 monoclonal antibody (M01A), clone 5H7 View larger

FBXO5 monoclonal antibody (M01A), clone 5H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO5 monoclonal antibody (M01A), clone 5H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FBXO5 monoclonal antibody (M01A), clone 5H7

Brand: Abnova
Reference: H00026271-M01A
Product name: FBXO5 monoclonal antibody (M01A), clone 5H7
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO5.
Clone: 5H7
Isotype: IgG1 Kappa
Gene id: 26271
Gene name: FBXO5
Gene alias: EMI1|FBX5|Fbxo31
Gene description: F-box protein 5
Genbank accession: NM_012177
Immunogen: FBXO5 (NP_036309, 358 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRR
Protein accession: NP_036309
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026271-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO5 monoclonal antibody (M01A), clone 5H7 now

Add to cart