Brand: | Abnova |
Reference: | H00026270-M02A |
Product name: | FBXO6 monoclonal antibody (M02A), clone 7D1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FBXO6. |
Clone: | 7D1 |
Isotype: | IgM Kappa |
Gene id: | 26270 |
Gene name: | FBXO6 |
Gene alias: | FBG2|FBS2|FBX6|Fbx6b |
Gene description: | F-box protein 6 |
Genbank accession: | BC020880 |
Immunogen: | FBXO6 (AAH20880.1, 1 a.a. ~ 293 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF |
Protein accession: | AAH20880.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (57.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of FBXO6 transfected lysate using anti-FBXO6 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FBXO6 MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |