FBXO6 monoclonal antibody (M01), clone 3F10 View larger

FBXO6 monoclonal antibody (M01), clone 3F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO6 monoclonal antibody (M01), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about FBXO6 monoclonal antibody (M01), clone 3F10

Brand: Abnova
Reference: H00026270-M01
Product name: FBXO6 monoclonal antibody (M01), clone 3F10
Product description: Mouse monoclonal antibody raised against a full length recombinant FBXO6.
Clone: 3F10
Isotype: IgG1 kappa
Gene id: 26270
Gene name: FBXO6
Gene alias: FBG2|FBS2|FBX6|Fbx6b
Gene description: F-box protein 6
Genbank accession: BC020880
Immunogen: FBXO6 (AAH20880.1, 1 a.a. ~ 293 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Protein accession: AAH20880.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026270-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026270-M01-13-15-1.jpg
Application image note: Western Blot analysis of FBXO6 expression in transfected 293T cell line by FBXO6 monoclonal antibody (M01), clone 3F10.

Lane 1: FBXO6 transfected lysate(33.933 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy FBXO6 monoclonal antibody (M01), clone 3F10 now

Add to cart