FBXO8 monoclonal antibody (M01), clone 1C11 View larger

FBXO8 monoclonal antibody (M01), clone 1C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO8 monoclonal antibody (M01), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FBXO8 monoclonal antibody (M01), clone 1C11

Brand: Abnova
Reference: H00026269-M01
Product name: FBXO8 monoclonal antibody (M01), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO8.
Clone: 1C11
Isotype: IgG1 Kappa
Gene id: 26269
Gene name: FBXO8
Gene alias: DC10|FBS|FBX8
Gene description: F-box protein 8
Genbank accession: NM_012180
Immunogen: FBXO8 (NP_036312, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPE
Protein accession: NP_036312
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026269-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026269-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged FBXO8 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO8 monoclonal antibody (M01), clone 1C11 now

Add to cart