FBXO9 monoclonal antibody (M06), clone 1G12 View larger

FBXO9 monoclonal antibody (M06), clone 1G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO9 monoclonal antibody (M06), clone 1G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA

More info about FBXO9 monoclonal antibody (M06), clone 1G12

Brand: Abnova
Reference: H00026268-M06
Product name: FBXO9 monoclonal antibody (M06), clone 1G12
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO9.
Clone: 1G12
Isotype: IgG2a Kappa
Gene id: 26268
Gene name: FBXO9
Gene alias: DKFZp434C0118|FBX9|KIAA0936|NY-REN-57|VCIA1|dJ341E18.2
Gene description: F-box protein 9
Genbank accession: NM_012347
Immunogen: FBXO9 (NP_036479, 338 a.a. ~ 447 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL
Protein accession: NP_036479
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026268-M06-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FBXO9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy FBXO9 monoclonal antibody (M06), clone 1G12 now

Add to cart