Brand: | Abnova |
Reference: | H00026268-M06 |
Product name: | FBXO9 monoclonal antibody (M06), clone 1G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXO9. |
Clone: | 1G12 |
Isotype: | IgG2a Kappa |
Gene id: | 26268 |
Gene name: | FBXO9 |
Gene alias: | DKFZp434C0118|FBX9|KIAA0936|NY-REN-57|VCIA1|dJ341E18.2 |
Gene description: | F-box protein 9 |
Genbank accession: | NM_012347 |
Immunogen: | FBXO9 (NP_036479, 338 a.a. ~ 447 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL |
Protein accession: | NP_036479 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to FBXO9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |