FBXO22 monoclonal antibody (M01), clone 6G9 View larger

FBXO22 monoclonal antibody (M01), clone 6G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO22 monoclonal antibody (M01), clone 6G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FBXO22 monoclonal antibody (M01), clone 6G9

Brand: Abnova
Reference: H00026263-M01
Product name: FBXO22 monoclonal antibody (M01), clone 6G9
Product description: Mouse monoclonal antibody raised against a full length recombinant FBXO22.
Clone: 6G9
Isotype: IgG1 Kappa
Gene id: 26263
Gene name: FBXO22
Gene alias: FBX22|FISTC1|FLJ13986|MGC31799
Gene description: F-box protein 22
Genbank accession: BC039024
Immunogen: FBXO22 (AAH39024, 1 a.a. ~ 299 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Protein accession: AAH39024
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026263-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (58.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026263-M01-1-25-1.jpg
Application image note: FBXO22 monoclonal antibody (M01), clone 6G9 Western Blot analysis of FBXO22 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO22 monoclonal antibody (M01), clone 6G9 now

Add to cart