FBXO24 monoclonal antibody (M01), clone 7F12 View larger

FBXO24 monoclonal antibody (M01), clone 7F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO24 monoclonal antibody (M01), clone 7F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about FBXO24 monoclonal antibody (M01), clone 7F12

Brand: Abnova
Reference: H00026261-M01
Product name: FBXO24 monoclonal antibody (M01), clone 7F12
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO24.
Clone: 7F12
Isotype: IgG1 Kappa
Gene id: 26261
Gene name: FBXO24
Gene alias: DKFZp434I1122|FBX24
Gene description: F-box protein 24
Genbank accession: NM_033506
Immunogen: FBXO24 (NP_277041, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPW
Protein accession: NP_277041
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy FBXO24 monoclonal antibody (M01), clone 7F12 now

Add to cart